Selenoprotein P Antikörper (N-Term)

Produktnummer ABIN631287

Dieses Anti-Selenoprotein P-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Selenoprotein P in WB. Geeignet für Human.

Kurzübersicht für Selenoprotein P Antikörper (N-Term) (ABIN631287)

Target: Selenoprotein P (SEPP1)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Selenoprotein P Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Selenoprotein P Antikörper

Bindungsspezifität: N-Term

Spezifität: SEPP1 antibody was raised against the N terminal of SEPP1

Aufreinigung: Affinity purified

Immunogen: SEPP1 antibody was raised using the N terminal of SEPP1 corresponding to a region with amino acids LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SEPP1 Blocking Peptide, (ABIN940370), is also available for use as a blocking control in assays to test for specificity of this SEPP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEPP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Selenoprotein P

Target: Selenoprotein P (SEPP1)

Andere Bezeichnung: SEPP1

Hintergrund: SEPP1 is a selenoprotein containing multiple selenocysteine (Sec) residues, which are encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This selenoprotein is an extracellular glycoprotein, and is unusual in that it contains 10 Sec residues per polypeptide. It is a heparin-binding protein that appears to be associated with endothelial cells, and has been implicated to function as an antioxidant in the extracellular space.

Molekulargewicht: 46 kDa (MW of target protein)