PANK4 Antikörper (N-Term)

Produktnummer ABIN631283

Der Kaninchen Polyklonal Anti-PANK4-Antikörper wurde für WB validiert. Er ist geeignet, PANK4 in Proben von Human zu detektieren.

Kurzübersicht für PANK4 Antikörper (N-Term) (ABIN631283)

Target: PANK4 (Pantothenate Kinase 4 (PANK4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PANK4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PANK4 Antikörper

Bindungsspezifität: N-Term

Spezifität: PANK4 antibody was raised against the N terminal of PANK4

Aufreinigung: Affinity purified

Immunogen: PANK4 antibody was raised using the N terminal of PANK4 corresponding to a region with amino acids MAECGASGSGSSGDSLDKSITLPPDEIFRNLENAKRFAIDIGGSLTKLAY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PANK4 Blocking Peptide, (ABIN5615207), is also available for use as a blocking control in assays to test for specificity of this PANK4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANK4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PANK4

Target: PANK4 (Pantothenate Kinase 4 (PANK4))

Andere Bezeichnung: PANK4

Hintergrund: This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells.

Molekulargewicht: 86 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process