UNC45A Antikörper

Produktnummer ABIN631276

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch UNC45A in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für UNC45A Antikörper (ABIN631276)

Target: UNC45A (Unc-45 Homolog A (UNC45A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UNC45A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UNC45A Antikörper

Aufreinigung: Affinity purified

Immunogen: UNC45 A antibody was raised using a synthetic peptide corresponding to a region with amino acids REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UNC45A Blocking Peptide, (ABIN5616909), is also available for use as a blocking control in assays to test for specificity of this UNC45A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC40 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UNC45A

Target: UNC45A (Unc-45 Homolog A (UNC45A))

Andere Bezeichnung: UNC45A

Hintergrund: UNC45A plays a role in cell proliferation and myoblast fusion, binds progesterone receptor and HSP90, and acts as a regulator of the progesterone receptor chaperoning pathway.

Molekulargewicht: 102 kDa (MW of target protein)