DDIT4L Antikörper (Middle Region)

Produktnummer ABIN631272

Dieser Anti-DDIT4L Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von DDIT4L in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für DDIT4L Antikörper (Middle Region) (ABIN631272)

Target: DDIT4L (DNA-Damage-Inducible Transcript 4-Like (DDIT4L))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDIT4L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DDIT4L Antikörper

Bindungsspezifität: Middle Region

Spezifität: DDIT4 L antibody was raised against the middle region of DDIT4

Aufreinigung: Affinity purified

Immunogen: DDIT4 L antibody was raised using the middle region of DDIT4 corresponding to a region with amino acids KLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDIT4L Blocking Peptide, (ABIN939895), is also available for use as a blocking control in assays to test for specificity of this DDIT4L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDIT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDIT4L

Target: DDIT4L (DNA-Damage-Inducible Transcript 4-Like (DDIT4L))

Andere Bezeichnung: DDIT4L

Hintergrund: DDIT4L inhibits cell growth by regulating the FRAP1 pathway upstream of the TSC1-TSC2 complex and downstream of AKT1.

Molekulargewicht: 22 kDa (MW of target protein)