RHPN1 Antikörper (Middle Region)

Produktnummer ABIN631270

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch RHPN1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für RHPN1 Antikörper (Middle Region) (ABIN631270)

Target: RHPN1 (Rhophilin, rho GTPase Binding Protein 1 (RHPN1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RHPN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RHPN1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RHPN1 antibody was raised against the middle region of RHPN1

Aufreinigung: Affinity purified

Immunogen: RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RHPN1 Blocking Peptide, (ABIN5615867), is also available for use as a blocking control in assays to test for specificity of this RHPN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHPN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RHPN1

Target: RHPN1 (Rhophilin, rho GTPase Binding Protein 1 (RHPN1))

Andere Bezeichnung: RHPN1

Hintergrund: RHPN1 has no enzymatic activity. RHPN1 may serve as a target for Rho, and interact with some cytoskeletal component upon Rho binding or relay a Rho signal to other molecules.

Molekulargewicht: 73 kDa (MW of target protein)