CSNK2A1/CK II alpha Antikörper (Middle Region)

Produktnummer ABIN631269

Dieses Anti-CSNK2A1/CK II alpha-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CSNK2A1/CK II alpha in WB. Geeignet für Human, Maus, Ratte, Drosophila melanogaster und C. elegans.

Kurzübersicht für CSNK2A1/CK II alpha Antikörper (Middle Region) (ABIN631269)

Target: CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))

Reaktivität: Human, Maus, Ratte, Drosophila melanogaster, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CSNK2A1/CK II alpha Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CSNK2A1/CK II alpha Antikörper

Bindungsspezifität: Middle Region

Spezifität: CK2 alpha 1 antibody was raised against the middle region of CSNK2 A1

Aufreinigung: Affinity purified

Immunogen: CK2 alpha 1 antibody was raised using the middle region of CSNK2 A1 corresponding to a region with amino acids LGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CK2 alpha 1 Blocking Peptide, catalog no. 33R-4966, is also available for use as a blocking control in assays to test for specificity of this CK2 alpha 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CSNK2A1/CK II alpha

Target: CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))

Hintergrund: Casein kinase II is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. The kinase exists as a tetramer and is composed of an alpha, an alpha-prime, and two beta subunits. The alpha subunits contain the catalytic activity while the beta subunits undergo autophosphorylation. CSNK2A1 represents the alpha subunit.

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom