NUDCD1 Antikörper (N-Term)

Produktnummer ABIN631265

Produktdetails anti-NUDCD1 Antikörper

Target: NUDCD1 (NudC Domain Containing 1 (NUDCD1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NUDCD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NUDCD1 antibody was raised against the N terminal of NUDCD1

Aufreinigung: Affinity purified

Immunogen: NUDCD1 antibody was raised using the N terminal of NUDCD1 corresponding to a region with amino acids EVAANCSLRVKRPLLDPRFEGYKLSLEPLPCYQLELDAAVAEVKLRDDQY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NUDCD1 Blocking Peptide, catalog no. 33R-2773, is also available for use as a blocking control in assays to test for specificity of this NUDCD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDCD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NUDCD1

Target: NUDCD1 (NudC Domain Containing 1 (NUDCD1))

Andere Bezeichnung: NUDCD1 (NUDCD1 Produkte)

Synonyme: Cml66 antikoerper, NUDCD1 antikoerper, CML66 antikoerper, OVA66 antikoerper, 4921532K09Rik antikoerper, AA407246 antikoerper, AW260430 antikoerper, AW556235 antikoerper, CML66-L antikoerper, RGD1310624 antikoerper, im:6901299 antikoerper, im:6912119 antikoerper, wu:fc11c02 antikoerper, zgc:110705 antikoerper, cml66 antikoerper, NudC domain containing 1 antikoerper, NudC domain-containing protein 1 antikoerper, NudC domain containing 1 S homeolog antikoerper, NUDCD1 antikoerper, nudcd1 antikoerper, CpipJ_CPIJ019282 antikoerper, nudc1 antikoerper, LOC777229 antikoerper, Nudcd1 antikoerper, nudcd1.S antikoerper

Hintergrund: NUDCD1 (CML66) contains 1 CS domain. It may play an oncogenic role in ways of favoring tumor cells proliferation, invasion and metastasis-associated with multiple pathways.

Molekulargewicht: 67 kDa (MW of target protein)