NUDCD1 Antikörper (N-Term)

Produktnummer ABIN631265

Der Kaninchen Polyklonal Anti-NUDCD1-Antikörper wurde für WB validiert. Er ist geeignet, NUDCD1 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für NUDCD1 Antikörper (N-Term) (ABIN631265)

Target: NUDCD1 (NudC Domain Containing 1 (NUDCD1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NUDCD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NUDCD1 Antikörper

Bindungsspezifität: N-Term

Spezifität: NUDCD1 antibody was raised against the N terminal of NUDCD1

Aufreinigung: Affinity purified

Immunogen: NUDCD1 antibody was raised using the N terminal of NUDCD1 corresponding to a region with amino acids EVAANCSLRVKRPLLDPRFEGYKLSLEPLPCYQLELDAAVAEVKLRDDQY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NUDCD1 Blocking Peptide, (ABIN938159), is also available for use as a blocking control in assays to test for specificity of this NUDCD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDCD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NUDCD1

Target: NUDCD1 (NudC Domain Containing 1 (NUDCD1))

Andere Bezeichnung: NUDCD1

Hintergrund: NUDCD1 (CML66) contains 1 CS domain. It may play an oncogenic role in ways of favoring tumor cells proliferation, invasion and metastasis-associated with multiple pathways.

Molekulargewicht: 67 kDa (MW of target protein)