TSKS Antikörper (N-Term)

Produktnummer ABIN631260

Der Kaninchen Polyklonal anti-TSKS Antikörper (ABIN631260) detektiert spezifisch TSKS in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für TSKS Antikörper (N-Term) (ABIN631260)

Target: TSKS (Testis-Specific serine Kinase Substrate (TSKS))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TSKS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TSKS Antikörper

Bindungsspezifität: N-Term

Spezifität: TSKS antibody was raised against the N terminal of TSKS

Aufreinigung: Affinity purified

Immunogen: TSKS antibody was raised using the N terminal of TSKS corresponding to a region with amino acids MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TSKS Blocking Peptide, (ABIN5616827), is also available for use as a blocking control in assays to test for specificity of this TSKS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSKS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TSKS

Target: TSKS (Testis-Specific serine Kinase Substrate (TSKS))

Andere Bezeichnung: TSKS

Hintergrund: TSKS may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of TSKS is highest in the testis and down-regulated in testicular cancer.

Molekulargewicht: 65 kDa (MW of target protein)

Pathways: Toll-Like Receptors Cascades