TDO2 Antikörper (N-Term)

Produktnummer ABIN631259

Der Kaninchen Polyklonal Anti-TDO2-Antikörper wurde für WB validiert. Er ist geeignet, TDO2 in Proben von Human zu detektieren.

Kurzübersicht für TDO2 Antikörper (N-Term) (ABIN631259)

Target: TDO2 (Tryptophan 2,3-Dioxygenase (TDO2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TDO2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TDO2 Antikörper

Bindungsspezifität: N-Term

Spezifität: TDO2 antibody was raised against the N terminal of TDO2

Aufreinigung: Affinity purified

Immunogen: TDO2 antibody was raised using the N terminal of TDO2 corresponding to a region with amino acids LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TDO2 Blocking Peptide, (ABIN940326), is also available for use as a blocking control in assays to test for specificity of this TDO2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TDO2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TDO2

Target: TDO2 (Tryptophan 2,3-Dioxygenase (TDO2))

Andere Bezeichnung: TDO2

Hintergrund: Tryptophan 2,3-dioxygenase (EC 1.13.11.11) plays a role in catalyzing the first and rat-limiting step in the kynurenine pathway, the major pathway of tryptophan metabolism.

Molekulargewicht: 48 kDa (MW of target protein)