EHD4 Antikörper (Middle Region)

Produktnummer ABIN631254

Dieses Anti-EHD4-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von EHD4 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für EHD4 Antikörper (Middle Region) (ABIN631254)

Target: EHD4 (EH-Domain Containing 4 (EHD4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EHD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EHD4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: EHD4 antibody was raised against the middle region of EHD4

Aufreinigung: Affinity purified

Immunogen: EHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids LMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EHD4 Blocking Peptide, (ABIN5613320), is also available for use as a blocking control in assays to test for specificity of this EHD4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EHD4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EHD4

Target: EHD4 (EH-Domain Containing 4 (EHD4))

Andere Bezeichnung: EHD4

Hintergrund: EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway.

Molekulargewicht: 61 kDa (MW of target protein)