EHD4 Antikörper (Middle Region)
-
- Target Alle EHD4 Antikörper anzeigen
- EHD4 (EH-Domain Containing 4 (EHD4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EHD4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EHD4 antibody was raised against the middle region of EHD4
- Aufreinigung
- Affinity purified
- Immunogen
- EHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids KAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPT
- Top Product
- Discover our top product EHD4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EHD4 Blocking Peptide, catalog no. 33R-4251, is also available for use as a blocking control in assays to test for specificity of this EHD4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EHD4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EHD4 (EH-Domain Containing 4 (EHD4))
- Andere Bezeichnung
- EHD4 (EHD4 Produkte)
- Synonyme
- EHD4 antikoerper, past4 antikoerper, PAST4 antikoerper, 2210022F10Rik antikoerper, AI197390 antikoerper, AI846352 antikoerper, AV006278 antikoerper, Past2 antikoerper, EH domain containing 4 antikoerper, EH-domain containing 4 antikoerper, EH domain containing 4 L homeolog antikoerper, EHD4 antikoerper, ehd4 antikoerper, ehd4.L antikoerper, Ehd4 antikoerper
- Hintergrund
- EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway.
- Molekulargewicht
- 61 kDa (MW of target protein)
-