EHD4 Antikörper (Middle Region)

Produktnummer ABIN631253

Produktdetails anti-EHD4 Antikörper

Target: EHD4 (EH-Domain Containing 4 (EHD4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EHD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EHD4 antibody was raised against the middle region of EHD4

Aufreinigung: Affinity purified

Immunogen: EHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids KAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EHD4 Blocking Peptide, catalog no. 33R-4251, is also available for use as a blocking control in assays to test for specificity of this EHD4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EHD4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EHD4

Target: EHD4 (EH-Domain Containing 4 (EHD4))

Andere Bezeichnung: EHD4 (EHD4 Produkte)

Synonyme: EHD4 antikoerper, past4 antikoerper, PAST4 antikoerper, 2210022F10Rik antikoerper, AI197390 antikoerper, AI846352 antikoerper, AV006278 antikoerper, Past2 antikoerper, EH domain containing 4 antikoerper, EH-domain containing 4 antikoerper, EH domain containing 4 L homeolog antikoerper, EHD4 antikoerper, ehd4 antikoerper, ehd4.L antikoerper, Ehd4 antikoerper

Hintergrund: EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway.

Molekulargewicht: 61 kDa (MW of target protein)