ACP6 Antikörper (N-Term)

Produktnummer ABIN631247

Produktdetails anti-ACP6 Antikörper

Target: ACP6 (Acid Phosphatase 6, Lysophosphatidic (ACP6))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACP6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACP6 antibody was raised against the N terminal of ACP6

Aufreinigung: Affinity purified

Immunogen: ACP6 antibody was raised using the N terminal of ACP6 corresponding to a region with amino acids EADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPLEEQVEWNPQLLEVPP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACP6 Blocking Peptide, catalog no. 33R-2253, is also available for use as a blocking control in assays to test for specificity of this ACP6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACP6

Target: ACP6 (Acid Phosphatase 6, Lysophosphatidic (ACP6))

Andere Bezeichnung: ACP6 (ACP6 Produkte)

Synonyme: ACP6 antikoerper, im:7147584 antikoerper, zgc:172268 antikoerper, MGC146066 antikoerper, ACPL1 antikoerper, LPAP antikoerper, PACPL1 antikoerper, 5730559A09Rik antikoerper, AU022842 antikoerper, mPACPL1 antikoerper, acid phosphatase 6, lysophosphatidic antikoerper, acid phosphatase 6, lysophosphatidic S homeolog antikoerper, ACP6 antikoerper, acp6 antikoerper, acp6.S antikoerper, Acp6 antikoerper

Hintergrund: ACP6 could hydrolyze lysophosphatidic acid to monoacylglycerol. It was originally reported to be located in the mitochondrion, but the evidence seems to be weak and contradictory with the presence of a cleaved signal sequence.

Molekulargewicht: 49 kDa (MW of target protein)