ACP6 Antikörper (N-Term)

Produktnummer ABIN631247

Der Kaninchen Polyklonal Anti-ACP6-Antikörper wurde für WB validiert. Er ist geeignet, ACP6 in Proben von Human und Maus zu detektieren.

Kurzübersicht für ACP6 Antikörper (N-Term) (ABIN631247)

Target: ACP6 (Acid Phosphatase 6, Lysophosphatidic (ACP6))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACP6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACP6 Antikörper

Bindungsspezifität: N-Term

Spezifität: ACP6 antibody was raised against the N terminal of ACP6

Aufreinigung: Affinity purified

Immunogen: ACP6 antibody was raised using the N terminal of ACP6 corresponding to a region with amino acids EADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPLEEQVEWNPQLLEVPP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACP6 Blocking Peptide, (ABIN937639), is also available for use as a blocking control in assays to test for specificity of this ACP6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACP6

Target: ACP6 (Acid Phosphatase 6, Lysophosphatidic (ACP6))

Andere Bezeichnung: ACP6

Hintergrund: ACP6 could hydrolyze lysophosphatidic acid to monoacylglycerol. It was originally reported to be located in the mitochondrion, but the evidence seems to be weak and contradictory with the presence of a cleaved signal sequence.

Molekulargewicht: 49 kDa (MW of target protein)