MAK Antikörper (C-Term)

Produktnummer ABIN631245

Der Kaninchen Polyklonal anti-MAK Antikörper (ABIN631245) detektiert spezifisch MAK in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Ratte und Maus.

Kurzübersicht für MAK Antikörper (C-Term) (ABIN631245)

Target: MAK (Male Germ Cell-Associated Kinase (MAK))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MAK Antikörper

Bindungsspezifität: C-Term

Spezifität: MAK antibody was raised against the C terminal of MAK

Aufreinigung: Affinity purified

Immunogen: MAK antibody was raised using the C terminal of MAK corresponding to a region with amino acids WNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAK Blocking Peptide, (ABIN5614640), is also available for use as a blocking control in assays to test for specificity of this MAK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAK

Target: MAK (Male Germ Cell-Associated Kinase (MAK))

Andere Bezeichnung: MAK

Hintergrund: MAK is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. It is expressed almost exclusively in the testis, primarily in germ cells. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. There is, however, a study of the mouse homolog that has identified high levels of expression in developing sensory epithelia so its function may be more generalized.

Molekulargewicht: 70 kDa (MW of target protein)