UMPS Antikörper (C-Term)

Produktnummer ABIN631243

Produktdetails anti-UMPS Antikörper

Target: UMPS (Uridine Monophosphate Synthetase (UMPS))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UMPS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UMPS antibody was raised against the C terminal of UMPS

Aufreinigung: Affinity purified

Immunogen: UMPS antibody was raised using the C terminal of UMPS corresponding to a region with amino acids VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDII

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UMPS Blocking Peptide, catalog no. 33R-9552, is also available for use as a blocking control in assays to test for specificity of this UMPS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UMPS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UMPS

Target: UMPS (Uridine Monophosphate Synthetase (UMPS))

Andere Bezeichnung: UMPS (UMPS Produkte)

Synonyme: zgc:55702 antikoerper, zgc:55723 antikoerper, UMPS antikoerper, OPRT antikoerper, 1700095D23Rik antikoerper, AA408257 antikoerper, AL033308 antikoerper, BB164745 antikoerper, Orotidine 5'-phosphate decarboxylase antikoerper, uridine monophosphate synthetase antikoerper, uridine monophosphate synthetase L homeolog antikoerper, uridine 5'-monophosphate synthase antikoerper, umps-1 antikoerper, umps antikoerper, umps.L antikoerper, UMPS antikoerper, LOC100556619 antikoerper, Umps antikoerper

Hintergrund: OPRT (UMPS) is involved in early events of pancreatic and gallbladder carcinogenesis and invasion of hepatocellular carcinomas. Orotate phosphoribosyltransferase is involved in the invasion and metastasis of colorectal carcinoma. Determination of OPRT levels in gastric carcinoma tissue enables to predict the response to S-1-based neoadjuvant/adjuvant chemotherapy.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process