PHKG2 Antikörper

Produktnummer ABIN631242

Dieses Anti-PHKG2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PHKG2 in WB und IHC. Geeignet für Human und Hund.

Kurzübersicht für PHKG2 Antikörper (ABIN631242)

Target: PHKG2 (phosphorylase Kinase, gamma 2 (Testis) (PHKG2))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PHKG2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PHKG2 Antikörper

Aufreinigung: Affinity purified

Immunogen: PHKG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PHKG2 Blocking Peptide, (ABIN937695), is also available for use as a blocking control in assays to test for specificity of this PHKG2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHKG2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PHKG2

Target: PHKG2 (phosphorylase Kinase, gamma 2 (Testis) (PHKG2))

Andere Bezeichnung: PHKG2

Hintergrund: Mutations in PHKG2 along with PHKA2 and PHKB, all three different genes of phosphorylase kinase (Phk) subunits, can give rise to glycogen storage disease of the liver. The autosomal-recessive, liver-specific variant of Phk deficiency is caused by mutations in the gene encoding the testis/liver isoform of the catalytic gamma subunit, PHKG2.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process, Regulation of Carbohydrate Metabolic Process