FERMT1 Antikörper
-
- Target Alle FERMT1 Antikörper anzeigen
- FERMT1 (Fermitin Family Member 1 (FERMT1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FERMT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- FERMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQIN
- Top Product
- Discover our top product FERMT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FERMT1 Blocking Peptide, catalog no. 33R-5456, is also available for use as a blocking control in assays to test for specificity of this FERMT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FERMT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FERMT1 (Fermitin Family Member 1 (FERMT1))
- Andere Bezeichnung
- FERMT1 (FERMT1 Produkte)
- Synonyme
- C20orf42 antikoerper, DTGCU2 antikoerper, KIND1 antikoerper, UNC112A antikoerper, URP1 antikoerper, 5830467P10Rik antikoerper, Kindlin-1 antikoerper, RGD1306816 antikoerper, si:ch73-22c10.1 antikoerper, wu:fc32b07 antikoerper, fermitin family member 1 antikoerper, fermitin family member 1 S homeolog antikoerper, fermitin family homolog 1 antikoerper, FERMT1 antikoerper, Fermt1 antikoerper, fermt1.S antikoerper, fermt1 antikoerper, LOC100548276 antikoerper
- Hintergrund
- FERMT1 is involved in cell adhesion, possibly via its interaction with integrins. It may mediate TGF-beta 1 signaling in tumor progression. Defects in FERMT1 are the cause of Kindler syndrome.
- Molekulargewicht
- 77 kDa (MW of target protein)
-