FERMT1 Antikörper

Produktnummer ABIN631240

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch FERMT1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für FERMT1 Antikörper (ABIN631240)

Target: FERMT1 (Fermitin Family Member 1 (FERMT1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FERMT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FERMT1 Antikörper

Aufreinigung: Affinity purified

Immunogen: FERMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQIN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FERMT1 Blocking Peptide, (ABIN5613571), is also available for use as a blocking control in assays to test for specificity of this FERMT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FERMT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FERMT1

Target: FERMT1 (Fermitin Family Member 1 (FERMT1))

Andere Bezeichnung: FERMT1

Hintergrund: FERMT1 is involved in cell adhesion, possibly via its interaction with integrins. It may mediate TGF-beta 1 signaling in tumor progression. Defects in FERMT1 are the cause of Kindler syndrome.

Molekulargewicht: 77 kDa (MW of target protein)