MPP3 Antikörper
Kurzübersicht für MPP3 Antikörper (ABIN631235)
Target
Alle MPP3 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Aufreinigung
- Affinity purified
-
Immunogen
- MPP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDVFSEKSLSYLMKIHEKLRYYERQSPTPVLHSAVALAEDVMEELQAASV
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
MPP3 Blocking Peptide, (ABIN5614827), is also available for use as a blocking control in assays to test for specificity of this MPP3 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPP3 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
- Avoid repeated freeze/thaw cycles.
-
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- MPP3 (Membrane Protein, Palmitoylated 3 (MAGUK P55 Subfamily Member 3) (MPP3))
-
Andere Bezeichnung
- MPP3
-
Hintergrund
- This gene product is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions
-
Molekulargewicht
- 66 kDa (MW of target protein)
Target
-