MPP3 Antikörper

Produktnummer ABIN631235

Der Kaninchen Polyklonal anti-MPP3 Antikörper wird verwendet zum Nachweis von MPP3 in Proben von Human, Ratte und Maus. Er wurde validiert für WB.

Kurzübersicht für MPP3 Antikörper (ABIN631235)

Target: MPP3 (Membrane Protein, Palmitoylated 3 (MAGUK P55 Subfamily Member 3) (MPP3))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MPP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MPP3 Antikörper

Aufreinigung: Affinity purified

Immunogen: MPP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDVFSEKSLSYLMKIHEKLRYYERQSPTPVLHSAVALAEDVMEELQAASV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MPP3 Blocking Peptide, (ABIN5614827), is also available for use as a blocking control in assays to test for specificity of this MPP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPP3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MPP3

Target: MPP3 (Membrane Protein, Palmitoylated 3 (MAGUK P55 Subfamily Member 3) (MPP3))

Andere Bezeichnung: MPP3

Hintergrund: This gene product is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions

Molekulargewicht: 66 kDa (MW of target protein)