MTMR12 Antikörper (Middle Region)

Produktnummer ABIN631233

Dieses Anti-MTMR12-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von MTMR12 in WB. Geeignet für Human und Maus.

Kurzübersicht für MTMR12 Antikörper (Middle Region) (ABIN631233)

Target: MTMR12 (Myotubularin Related Protein 12 (MTMR12))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MTMR12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MTMR12 Antikörper

Bindungsspezifität: Middle Region

Spezifität: MTMR12 antibody was raised against the middle region of MTMR12

Aufreinigung: Affinity purified

Immunogen: MTMR12 antibody was raised using the middle region of MTMR12 corresponding to a region with amino acids RNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MTMR12 Blocking Peptide, (ABIN5614873), is also available for use as a blocking control in assays to test for specificity of this MTMR12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTMR12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MTMR12

Target: MTMR12 (Myotubularin Related Protein 12 (MTMR12))

Andere Bezeichnung: MTMR12

Hintergrund: MTMR12 inactives phosphatase that plays a role as an adapter for the phosphatase myotubularin to regulate myotubularin intracellular location.Phosphatidylinositide 3-kinase-derived membrane-anchored phosphatidylinositides, such as phosphatidylinositol 3-phosphate (PtdIns(3)P), regulate diverse cellular processes.

Molekulargewicht: 86 kDa (MW of target protein)