LCK Antikörper (N-Term)

Produktnummer ABIN631231

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch LCK in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für LCK Antikörper (N-Term) (ABIN631231)

Target: LCK (Lymphocyte-Specific Protein tyrosine Kinase (LCK))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LCK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LCK Antikörper

Bindungsspezifität: N-Term

Spezifität: LCK antibody was raised against the N terminal of LCK

Aufreinigung: Affinity purified

Immunogen: LCK antibody was raised using the N terminal of LCK corresponding to a region with amino acids PSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LCK Blocking Peptide, (ABIN5614426), is also available for use as a blocking control in assays to test for specificity of this LCK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LCK

Target: LCK (Lymphocyte-Specific Protein tyrosine Kinase (LCK))

Andere Bezeichnung: LCK

Hintergrund: LCK is a member of the Src family of protein tyrosine kinases (PTKs). It is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. LCK localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules.

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: T-Zell Rezeptor Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Transition Metal Ion Homeostasis, Positive Regulation of Endopeptidase Activity, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling