ISYNA1 Antikörper (N-Term)

Produktnummer ABIN631226

Der Kaninchen Polyklonal Anti-ISYNA1-Antikörper wurde für WB validiert. Er ist geeignet, ISYNA1 in Proben von Human zu detektieren.

Kurzübersicht für ISYNA1 Antikörper (N-Term) (ABIN631226)

Target: ISYNA1 (Inositol-3-Phosphate Synthase 1 (ISYNA1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ISYNA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ISYNA1 Antikörper

Bindungsspezifität: N-Term

Spezifität: ISYNA1 antibody was raised against the N terminal of ISYNA1

Aufreinigung: Affinity purified

Immunogen: ISYNA1 antibody was raised using the N terminal of ISYNA1 corresponding to a region with amino acids LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ISYNA1 Blocking Peptide, (ABIN5614221), is also available for use as a blocking control in assays to test for specificity of this ISYNA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISYNA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ISYNA1

Target: ISYNA1 (Inositol-3-Phosphate Synthase 1 (ISYNA1))

Andere Bezeichnung: ISYNA1

Hintergrund: Myoinositol, the most common naturally occurring form of inositol, is a component of plasma membrane phospholipids and functions as a cell signaling molecule. ISYNA1 (EC 5.5.1.4), or IPS, is a rate-limiting enzyme that catalyzes the de novo synthesis of myoinositol 1-phosphate from glucose 6-phosphate.

Molekulargewicht: 61 kDa (MW of target protein)