RAPSN Antikörper (N-Term)

Produktnummer ABIN631223

Produktdetails anti-RAPSN Antikörper

Target: RAPSN (Receptor-Associated Protein of The Synapse (RAPSN))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAPSN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RAPSN antibody was raised against the N terminal of RAPSN

Aufreinigung: Affinity purified

Immunogen: RAPSN antibody was raised using the N terminal of RAPSN corresponding to a region with amino acids MGQDQTKQQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLV

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAPSN Blocking Peptide, catalog no. 33R-6061, is also available for use as a blocking control in assays to test for specificity of this RAPSN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPSN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAPSN

Target: RAPSN (Receptor-Associated Protein of The Synapse (RAPSN))

Andere Bezeichnung: RAPSN (RAPSN Produkte)

Synonyme: RAPSN antikoerper, RAPSYN antikoerper, RNF205 antikoerper, 43kDa antikoerper, Nraps antikoerper, Raps antikoerper, rapsyn antikoerper, receptor associated protein of the synapse antikoerper, receptor associated protein of the synapse S homeolog antikoerper, receptor-associated protein of the synapse antikoerper, receptor-associated protein of the synapse, 43kD antikoerper, RAPSN antikoerper, rapsn.S antikoerper, Rapsn antikoerper, rapsn antikoerper

Hintergrund: RAPSN belongs to a family of proteins that are receptor associated proteins of the synapse. It contains a conserved cAMP-dependent protein kinase phosphorylation site. It is believed to play some role in anchoring or stabilizing the nicotinic acetylcholine receptor at synaptic sites. It may link the receptor to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin.

Molekulargewicht: 39 kDa (MW of target protein)