RAPSN Antikörper (N-Term)

Produktnummer ABIN631223

Der Kaninchen Polyklonal Anti-RAPSN-Antikörper wurde für WB validiert. Er ist geeignet, RAPSN in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für RAPSN Antikörper (N-Term) (ABIN631223)

Target: RAPSN (Receptor-Associated Protein of The Synapse (RAPSN))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAPSN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAPSN Antikörper

Bindungsspezifität: N-Term

Spezifität: RAPSN antibody was raised against the N terminal of RAPSN

Aufreinigung: Affinity purified

Immunogen: RAPSN antibody was raised using the N terminal of RAPSN corresponding to a region with amino acids MGQDQTKQQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLV

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAPSN Blocking Peptide, (ABIN5615759), is also available for use as a blocking control in assays to test for specificity of this RAPSN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPSN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAPSN

Target: RAPSN (Receptor-Associated Protein of The Synapse (RAPSN))

Andere Bezeichnung: RAPSN

Hintergrund: RAPSN belongs to a family of proteins that are receptor associated proteins of the synapse. It contains a conserved cAMP-dependent protein kinase phosphorylation site. It is believed to play some role in anchoring or stabilizing the nicotinic acetylcholine receptor at synaptic sites. It may link the receptor to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin.

Molekulargewicht: 39 kDa (MW of target protein)