TJAP1 Antikörper

Produktnummer ABIN631222

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TJAP1 in WB. Er zeigt eine Reaktivität gegenüber Human, Ratte und Maus.

Kurzübersicht für TJAP1 Antikörper (ABIN631222)

Target: TJAP1 (Tight Junction Associated Protein 1 (Peripheral) (TJAP1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TJAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TJAP1 Antikörper

Aufreinigung: Affinity purified

Immunogen: TJAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTSAAPAKKPYRKAPPEHRELRLEIPGSRLEQEEPLTDAERMKLLQEENE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TJAP1 Blocking Peptide, (ABIN5616615), is also available for use as a blocking control in assays to test for specificity of this TJAP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TJAP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TJAP1

Target: TJAP1 (Tight Junction Associated Protein 1 (Peripheral) (TJAP1))

Andere Bezeichnung: TJAP1

Hintergrund: TJAP1 interacts with DLG1. The exact function of TJAP1 remains unknown.

Molekulargewicht: 15 kDa (MW of target protein)