Ubiquilin 3 Antikörper (N-Term)
-
- Target Alle Ubiquilin 3 (UBQLN3) Antikörper anzeigen
- Ubiquilin 3 (UBQLN3)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Ubiquilin 3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Ubiquilin 3 antibody was raised against the N terminal of UBQLN3
- Aufreinigung
- Affinity purified
- Immunogen
- Ubiquilin 3 antibody was raised using the N terminal of UBQLN3 corresponding to a region with amino acids LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE
- Top Product
- Discover our top product UBQLN3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Ubiquilin 3 Blocking Peptide, catalog no. 33R-5210, is also available for use as a blocking control in assays to test for specificity of this Ubiquilin 3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBQLN3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Ubiquilin 3 (UBQLN3)
- Andere Bezeichnung
- Ubiquilin 3 (UBQLN3 Produkte)
- Synonyme
- TUP-1 antikoerper, 4933400K24Rik antikoerper, UBQLN3 antikoerper, ubiquilin 3 antikoerper, UBQLN3 antikoerper, Ubqln3 antikoerper
- Hintergrund
- UBQLN3 is an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation.
- Molekulargewicht
- 72 kDa (MW of target protein)
-