GALT Antikörper (C-Term)

Produktnummer ABIN631216

Produktdetails anti-GALT Antikörper

Target: GALT (Galactose-1-Phosphate Uridylyltransferase (GALT))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GALT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GALT antibody was raised against the C terminal of GALT

Aufreinigung: Affinity purified

Immunogen: GALT antibody was raised using the C terminal of GALT corresponding to a region with amino acids LLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYHLGQKDRET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GALT Blocking Peptide, catalog no. 33R-5189, is also available for use as a blocking control in assays to test for specificity of this GALT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GALT

Target: GALT (Galactose-1-Phosphate Uridylyltransferase (GALT))

Andere Bezeichnung: GALT (GALT Produkte)

Synonyme: GALT antikoerper, AW553376 antikoerper, CG9232 antikoerper, Dmel\\CG9232 antikoerper, dGALT antikoerper, galactose-1-phosphate uridylyltransferase antikoerper, galactose-1-phosphate uridylyltransferase, GalT antikoerper, probable galactose-1-phosphate uridylyltransferase galtb [second part] antikoerper, UDP-glucose--galactose-1-phosphate uridylyltransferase antikoerper, GalT galactose-1-phosphate uridylyltransferase antikoerper, galactose-1-phosphate uridyl transferase antikoerper, Galactose-1-phosphate uridylyltransferase antikoerper, galactose-1-phosphate uridylyltransferase S homeolog antikoerper, GALT antikoerper, galT antikoerper, Galt antikoerper, CNM00620 antikoerper, Mrub_2813 antikoerper, Mesil_2395 antikoerper, Trad_0989 antikoerper, Igag_1846 antikoerper, VDIS_RS10425 antikoerper, Intca_2810 antikoerper, Marky_2157 antikoerper, Selsp_1876 antikoerper, Trebr_2368 antikoerper, Halhy_5538 antikoerper, Theth_1357 antikoerper, galt.S antikoerper

Hintergrund: Galactose-1-phosphate uridyl transferase (GALT) catalyzes the second step of the Leloir pathway of galactose metabolism, namely the conversion of UDP-glucose + galactose-1-phosphate to glucose-1-phosphate + UDP-galactose. The absence of this enzyme results in classic galactosemia in humans and can be fatal in the newborn period if lactose is not removed from the diet.

Molekulargewicht: 43 kDa (MW of target protein)