AASDHPPT Antikörper (C-Term)

Produktnummer ABIN631211

Der Kaninchen-Polyklonal Anti-AASDHPPT-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von AASDHPPT in Proben aus Human. }

Kurzübersicht für AASDHPPT Antikörper (C-Term) (ABIN631211)

Target: AASDHPPT (Aminoadipate-Semialdehyde Dehydrogenase-phosphopantetheinyl Transferase (AASDHPPT))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AASDHPPT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AASDHPPT Antikörper

Bindungsspezifität: C-Term

Spezifität: AASDHPPT antibody was raised against the C terminal of AASDHPPT

Aufreinigung: Affinity purified

Immunogen: AASDHPPT antibody was raised using the C terminal of AASDHPPT corresponding to a region with amino acids SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AASDHPPT Blocking Peptide, (ABIN5611849), is also available for use as a blocking control in assays to test for specificity of this AASDHPPT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AASDHPPT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AASDHPPT

Target: AASDHPPT (Aminoadipate-Semialdehyde Dehydrogenase-phosphopantetheinyl Transferase (AASDHPPT))

Andere Bezeichnung: AASDHPPT

Hintergrund: AASDHPPT is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia.

Molekulargewicht: 36 kDa (MW of target protein)