UBASH3A Antikörper (Middle Region)

Produktnummer ABIN631208

Produktdetails anti-UBASH3A Antikörper

Target: UBASH3A (Ubiquitin Associated and SH3 Domain Containing, A (UBASH3A))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBASH3A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UBASH3 A antibody was raised against the middle region of UBASH3

Aufreinigung: Affinity purified

Immunogen: UBASH3 A antibody was raised using the middle region of UBASH3 corresponding to a region with amino acids PCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFASPA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBASH3A Blocking Peptide, catalog no. 33R-7001, is also available for use as a blocking control in assays to test for specificity of this UBASH3A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBASH0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBASH3A

Target: UBASH3A (Ubiquitin Associated and SH3 Domain Containing, A (UBASH3A))

Andere Bezeichnung: UBASH3A (UBASH3A Produkte)

Synonyme: UBASH3A antikoerper, CLIP4 antikoerper, STS-2 antikoerper, TULA antikoerper, TULA-1 antikoerper, 5830413C03Rik antikoerper, C330001M22 antikoerper, Sts-2 antikoerper, ubiquitin associated and SH3 domain containing A antikoerper, ubiquitin associated and SH3 domain containing, A antikoerper, UBASH3A antikoerper, Ubash3a antikoerper

Hintergrund: UBASH3A interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. It also promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface.

Molekulargewicht: 74 kDa (MW of target protein)