AMD1 Antikörper (N-Term)

Produktnummer ABIN631207

Produktdetails anti-AMD1 Antikörper

Target: AMD1 (Adenosylmethionine Decarboxylase 1 (AMD1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AMD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AMD1 antibody was raised against the N terminal of AMD1

Aufreinigung: Affinity purified

Immunogen: AMD1 antibody was raised using the N terminal of AMD1 corresponding to a region with amino acids MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AMD1 Blocking Peptide, catalog no. 33R-6068, is also available for use as a blocking control in assays to test for specificity of this AMD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AMD1

Target: AMD1 (Adenosylmethionine Decarboxylase 1 (AMD1))

Andere Bezeichnung: AMD1 (AMD1 Produkte)

Synonyme: ADOMETDC antikoerper, AMD antikoerper, SAMDC antikoerper, Amd1a antikoerper, Amd1b antikoerper, AMD1 antikoerper, AdoMetDC antikoerper, amd antikoerper, samdc antikoerper, fb26e03 antikoerper, si:ch211-257g8.2 antikoerper, wu:fb26e03 antikoerper, zgc:55614 antikoerper, 1 antikoerper, Amd-1 antikoerper, SAMDC 1 antikoerper, adoMetDC1 antikoerper, CG5029 antikoerper, Dmel\\CG5029 antikoerper, l(2)31Dc antikoerper, l(2)31Dd antikoerper, l(2)31De antikoerper, F16B3.10 antikoerper, F16B3_10 antikoerper, S-ADENOSYLMETHIONINE DECARBOXYLASE antikoerper, S-adenosylmethionine decarboxylase antikoerper, adenosylmethionine decarboxylase 1 antikoerper, S-adenosylmethionine decarboxylase 1 antikoerper, S-adenosyl methionine decarboxylase 2 antikoerper, adenosylmethionine decarboxylase 1 L homeolog antikoerper, S-adenosylmethionine decarboxylase antikoerper, AMD1 antikoerper, Amd1 antikoerper, amd1 antikoerper, sam2 antikoerper, amd1.L antikoerper, SamDC antikoerper, SAMDC antikoerper

Hintergrund: The specific function of AMD1 is not yet known.

Molekulargewicht: 21 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process