WDR6 Antikörper (C-Term)

Produktnummer ABIN631201

Produktdetails anti-WDR6 Antikörper

Target: WDR6 (WD Repeat Domain 6 (WDR6))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WDR6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: WDR6 antibody was raised against the C terminal of WDR6

Aufreinigung: Affinity purified

Immunogen: WDR6 antibody was raised using the C terminal of WDR6 corresponding to a region with amino acids TPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLE

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR6 Blocking Peptide, catalog no. 33R-9232, is also available for use as a blocking control in assays to test for specificity of this WDR6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WDR6

Target: WDR6 (WD Repeat Domain 6 (WDR6))

Andere Bezeichnung: WDR6 (WDR6 Produkte)

Synonyme: WDR6 antikoerper, mWDR6 antikoerper, WD repeat domain 6 antikoerper, WDR6 antikoerper, Wdr6 antikoerper

Hintergrund: WDR6 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.

Molekulargewicht: 53 kDa (MW of target protein)