IFT122 Antikörper

Produktnummer ABIN631200

Der Kaninchen Polyklonal anti-IFT122 Antikörper (ABIN631200) detektiert spezifisch IFT122 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für IFT122 Antikörper (ABIN631200)

Target: IFT122 (Intraflagellar Transport 122 (IFT122))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IFT122 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IFT122 Antikörper

Aufreinigung: Affinity purified

Immunogen: IFT122 antibody was raised using a synthetic peptide corresponding to a region with amino acids QADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNIS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IFT122 Blocking Peptide, (ABIN5614150), is also available for use as a blocking control in assays to test for specificity of this IFT122 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFT122 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IFT122

Target: IFT122 (Intraflagellar Transport 122 (IFT122))

Andere Bezeichnung: IFT122

Hintergrund: IFT122 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. IFT122 contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation.

Molekulargewicht: 129 kDa (MW of target protein)

Pathways: Tube Formation, Embryonic Body Morphogenesis