Rhotekin Antikörper (N-Term)

Produktnummer ABIN631197

Dieses Anti-Rhotekin-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Rhotekin in WB. Geeignet für Human, Ratte und Maus.

Kurzübersicht für Rhotekin Antikörper (N-Term) (ABIN631197)

Target: Rhotekin (RTKN)

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Rhotekin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Rhotekin Antikörper

Bindungsspezifität: N-Term

Spezifität: Rhotekin antibody was raised against the N terminal of RTKN

Aufreinigung: Affinity purified

Immunogen: Rhotekin antibody was raised using the N terminal of RTKN corresponding to a region with amino acids DSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Rhotekin Blocking Peptide, (ABIN937549), is also available for use as a blocking control in assays to test for specificity of this Rhotekin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTKN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Rhotekin

Target: Rhotekin (RTKN)

Andere Bezeichnung: Rhotekin

Hintergrund: RTKN mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. RTKN may play a novel role in the organization of septin structures.

Molekulargewicht: 63 kDa (MW of target protein)