Peripherin Antikörper (N-Term)

Produktnummer ABIN631185

Produktdetails anti-Peripherin Antikörper

Target: Peripherin (PRPH)

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Peripherin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRPH antibody was raised against the N terminal of PRPH

Aufreinigung: Affinity purified

Immunogen: PRPH antibody was raised using the N terminal of PRPH corresponding to a region with amino acids RFANFIEKVRFLEQQNAALRGELSQARGQEPARADQLCQQELRELRRELE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRPH Blocking Peptide, catalog no. 33R-7897, is also available for use as a blocking control in assays to test for specificity of this PRPH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Peripherin

Target: Peripherin (PRPH)

Andere Bezeichnung: PRPH (PRPH Produkte)

Synonyme: NEF4 antikoerper, PRPH1 antikoerper, Prph1 antikoerper, Perf antikoerper, nef4 antikoerper, prph1 antikoerper, MGC69454 antikoerper, if3 antikoerper, plasticin antikoerper, zgc:111926 antikoerper, peripherin antikoerper, peripherin L homeolog antikoerper, PRPH antikoerper, Prph antikoerper, prph antikoerper, prph.L antikoerper

Hintergrund: This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin.

Molekulargewicht: 54 kDa (MW of target protein)