OMP Antikörper (Middle Region)

Produktnummer ABIN631184

Produktdetails anti-OMP Antikörper

Target: OMP (Olfactory Marker Protein (OMP))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OMP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OMP antibody was raised against the middle region of OMP

Aufreinigung: Affinity purified

Immunogen: OMP antibody was raised using the middle region of OMP corresponding to a region with amino acids WRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OMP Blocking Peptide, catalog no. 33R-10003, is also available for use as a blocking control in assays to test for specificity of this OMP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OMP

Target: OMP (Olfactory Marker Protein (OMP))

Andere Bezeichnung: OMP (OMP Produkte)

Synonyme: omp antikoerper, zgc:101697 antikoerper, xomp1 antikoerper, xomp2 antikoerper, omp2-A antikoerper, MGC75776 antikoerper, OMP antikoerper, zgc:114158 antikoerper, olfactory marker protein antikoerper, olfactory marker protein b antikoerper, olfactory marker protein L homeolog antikoerper, olfactory marker protein S homeolog antikoerper, olfactory marker protein a antikoerper, Omp antikoerper, OMP antikoerper, ompb antikoerper, omp.L antikoerper, omp.S antikoerper, omp antikoerper, ompa antikoerper

Hintergrund: Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human.

Molekulargewicht: 19 kDa (MW of target protein)