OMP Antikörper (Middle Region)

Produktnummer ABIN631184

Der Kaninchen Polyklonal Anti-OMP-Antikörper wurde für WB validiert. Er ist geeignet, OMP in Proben von Human, Ratte und Maus zu detektieren.

Kurzübersicht für OMP Antikörper (Middle Region) (ABIN631184)

Target: OMP (Olfactory Marker Protein (OMP))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OMP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-OMP Antikörper

Bindungsspezifität: Middle Region

Spezifität: OMP antibody was raised against the middle region of OMP

Aufreinigung: Affinity purified

Immunogen: OMP antibody was raised using the middle region of OMP corresponding to a region with amino acids WRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OMP Blocking Peptide, (ABIN935955), is also available for use as a blocking control in assays to test for specificity of this OMP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OMP

Target: OMP (Olfactory Marker Protein (OMP))

Andere Bezeichnung: OMP

Hintergrund: Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human.

Molekulargewicht: 19 kDa (MW of target protein)