ALDOC Antikörper (C-Term)

Produktnummer ABIN631176

Dieses Anti-ALDOC-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ALDOC in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für ALDOC Antikörper (C-Term) (ABIN631176)

Target: ALDOC (Aldolase C, Fructose-Bisphosphate (ALDOC))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALDOC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ALDOC Antikörper

Bindungsspezifität: C-Term

Spezifität: ALDOC antibody was raised against the C terminal of ALDOC

Aufreinigung: Affinity purified

Immunogen: ALDOC antibody was raised using the C terminal of ALDOC corresponding to a region with amino acids CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALDOC Blocking Peptide, (ABIN937153), is also available for use as a blocking control in assays to test for specificity of this ALDOC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDOC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALDOC

Target: ALDOC (Aldolase C, Fructose-Bisphosphate (ALDOC))

Andere Bezeichnung: ALDOC

Hintergrund: ALDOC gene is a member of the class I fructose-biphosphate aldolase gene family. ALDOC is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.

Molekulargewicht: 39 kDa (MW of target protein)