PARD6A Antikörper

Produktnummer ABIN631173

Produktdetails anti-PARD6A Antikörper

Target: PARD6A (Par-6 Partitioning Defective 6 Homolog alpha (PARD6A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PARD6A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PARD6 A antibody was raised using a synthetic peptide corresponding to a region with amino acids MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PARD6A Blocking Peptide, catalog no. 33R-5734, is also available for use as a blocking control in assays to test for specificity of this PARD6A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARD0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PARD6A

Target: PARD6A (Par-6 Partitioning Defective 6 Homolog alpha (PARD6A))

Andere Bezeichnung: PARD6A (PARD6A Produkte)

Synonyme: PARD6A antikoerper, 0710008C04Rik antikoerper, 2610010A15Rik antikoerper, PAR6alpha antikoerper, Par-6 antikoerper, Par6 antikoerper, Par6c antikoerper, TAX40 antikoerper, Tip-40 antikoerper, Par-6a antikoerper, Par6a antikoerper, PAR-6A antikoerper, PAR6 antikoerper, PAR6C antikoerper, TIP-40 antikoerper, par-6 partitioning defective 6 homolog alpha (C. elegans) antikoerper, par-6 family cell polarity regulator alpha antikoerper, Partitioning defective protein 6 antikoerper, PARD6A antikoerper, Pard6a antikoerper, par-6 antikoerper

Hintergrund: This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization