IMPA2 Antikörper (Middle Region)

Produktnummer ABIN631172

Produktdetails anti-IMPA2 Antikörper

Target: IMPA2 (Inositol(myo)-1(or 4)-Monophosphatase 2 (IMPA2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IMPA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IMPA2 antibody was raised against the middle region of IMPA2

Aufreinigung: Affinity purified

Immunogen: IMPA2 antibody was raised using the middle region of IMPA2 corresponding to a region with amino acids RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IMPA2 Blocking Peptide, catalog no. 33R-7934, is also available for use as a blocking control in assays to test for specificity of this IMPA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IMPA2

Target: IMPA2 (Inositol(myo)-1(or 4)-Monophosphatase 2 (IMPA2))

Andere Bezeichnung: IMPA2 (IMPA2 Produkte)

Synonyme: zgc:110201 antikoerper, 2210415D20Rik antikoerper, AI326924 antikoerper, AW259601 antikoerper, inositol monophosphatase 2 antikoerper, inositol(myo)-1(or 4)-monophosphatase 2 antikoerper, inositol (myo)-1(or 4)-monophosphatase 2 antikoerper, IMPA2 antikoerper, impa2 antikoerper, MGYG_08537 antikoerper, Impa2 antikoerper

Hintergrund: IMPA2 belongs to the inositol monophosphatase family. The present study suggests that a promoter haplotype of IMPA2 possibly contributes to risk for bipolar disorder by elevating IMPA2 levels in the brain, albeit the genetic effect varies among populations.

Molekulargewicht: 32 kDa (MW of target protein)