ACSBG2 Antikörper (Middle Region)
-
- Target Alle ACSBG2 Antikörper anzeigen
- ACSBG2 (Acyl-CoA Synthetase Bubblegum Family Member 2 (ACSBG2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACSBG2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACSBG2 antibody was raised against the middle region of ACSBG2
- Aufreinigung
- Affinity purified
- Immunogen
- ACSBG2 antibody was raised using the middle region of ACSBG2 corresponding to a region with amino acids LNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCK
- Top Product
- Discover our top product ACSBG2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACSBG2 Blocking Peptide, catalog no. 33R-5237, is also available for use as a blocking control in assays to test for specificity of this ACSBG2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSBG2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACSBG2 (Acyl-CoA Synthetase Bubblegum Family Member 2 (ACSBG2))
- Andere Bezeichnung
- ACSBG2 (ACSBG2 Produkte)
- Hintergrund
- ACSBG2 mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. It is able to activate long-chain fatty acids. Also able to activate very long-chain fatty acids, however, the relevance of such activity is unclear in vivo. ACSBG2 has increased ability to activate oleic and linoleic acid. It may play a role in spermatogenesis.
- Molekulargewicht
- 68 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-