ACSBG2 Antikörper (Middle Region)

Produktnummer ABIN631171

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch ACSBG2 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für ACSBG2 Antikörper (Middle Region) (ABIN631171)

Target: ACSBG2 (Acyl-CoA Synthetase Bubblegum Family Member 2 (ACSBG2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACSBG2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACSBG2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ACSBG2 antibody was raised against the middle region of ACSBG2

Aufreinigung: Affinity purified

Immunogen: ACSBG2 antibody was raised using the middle region of ACSBG2 corresponding to a region with amino acids LNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACSBG2 Blocking Peptide, (ABIN5611917), is also available for use as a blocking control in assays to test for specificity of this ACSBG2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSBG2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACSBG2

Target: ACSBG2 (Acyl-CoA Synthetase Bubblegum Family Member 2 (ACSBG2))

Andere Bezeichnung: ACSBG2

Hintergrund: ACSBG2 mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. It is able to activate long-chain fatty acids. Also able to activate very long-chain fatty acids, however, the relevance of such activity is unclear in vivo. ACSBG2 has increased ability to activate oleic and linoleic acid. It may play a role in spermatogenesis.

Molekulargewicht: 68 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process