SULT6B1 Antikörper (C-Term)

Produktnummer ABIN631168

Produktdetails anti-SULT6B1 Antikörper

Target: SULT6B1 (Sulfotransferase Family, Cytosolic, 6B, Member 1 (SULT6B1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SULT6B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SULT6 B1 antibody was raised against the C terminal of SULT6 1

Aufreinigung: Affinity purified

Immunogen: SULT6 B1 antibody was raised using the C terminal of SULT6 1 corresponding to a region with amino acids FLGFFLTGEQIQTISVQSTFQAMRAKSQDTHGAVGPFLFRKGEVGDWKNL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SULT6B1 Blocking Peptide, catalog no. 33R-2961, is also available for use as a blocking control in assays to test for specificity of this SULT6B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SULT6B1

Target: SULT6B1 (Sulfotransferase Family, Cytosolic, 6B, Member 1 (SULT6B1))

Andere Bezeichnung: SULT6B1 (SULT6B1 Produkte)

Synonyme: 2410078J06Rik antikoerper, AV101767 antikoerper, ST6B1 antikoerper, sulfotransferase family 6B member 1 antikoerper, sulfotransferase family, cytosolic, 6B, member 1 antikoerper, SULT6B1 antikoerper, Sult6b1 antikoerper

Hintergrund: SULT6B1 belongs to the sulfotransferase 1 family. SULT6B1 may catalyze the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters.

Molekulargewicht: 30 kDa (MW of target protein)