GCHFR Antikörper (N-Term)

Produktnummer ABIN631166

Produktdetails anti-GCHFR Antikörper

Target: GCHFR (GTP Cyclohydrolase I Feedback Regulator (GCHFR))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GCHFR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GCHFR antibody was raised against the N terminal of GCHFR

Aufreinigung: Affinity purified

Immunogen: GCHFR antibody was raised using the N terminal of GCHFR corresponding to a region with amino acids MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GCHFR Blocking Peptide, catalog no. 33R-6313, is also available for use as a blocking control in assays to test for specificity of this GCHFR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCHFR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GCHFR

Target: GCHFR (GTP Cyclohydrolase I Feedback Regulator (GCHFR))

Andere Bezeichnung: GCHFR (GCHFR Produkte)

Synonyme: GFRP antikoerper, HsT16933 antikoerper, P35 antikoerper, 2010323F13Rik antikoerper, GTP cyclohydrolase I feedback regulator antikoerper, GCHFR antikoerper, Gchfr antikoerper

Hintergrund: GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide.

Molekulargewicht: 10 kDa (MW of target protein)