GAMT Antikörper (N-Term)

Produktnummer ABIN631157

Der Kaninchen Polyklonal Anti-GAMT-Antikörper wurde für WB validiert. Er ist geeignet, GAMT in Proben von Human zu detektieren.

Kurzübersicht für GAMT Antikörper (N-Term) (ABIN631157)

Target: GAMT (Guanidinoacetate N-Methyltransferase (GAMT))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GAMT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GAMT Antikörper

Bindungsspezifität: N-Term

Spezifität: GAMT antibody was raised against the N terminal of GAMT

Aufreinigung: Affinity purified

Immunogen: GAMT antibody was raised using the N terminal of GAMT corresponding to a region with amino acids MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYM

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GAMT Blocking Peptide, (ABIN5613722), is also available for use as a blocking control in assays to test for specificity of this GAMT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAMT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GAMT

Target: GAMT (Guanidinoacetate N-Methyltransferase (GAMT))

Andere Bezeichnung: GAMT

Hintergrund: GAMT is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in its gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumulation of guanidinoacetate in the brain of affected individuals.

Molekulargewicht: 26 kDa (MW of target protein)