APEH Antikörper (N-Term)
-
- Target Alle APEH Antikörper anzeigen
- APEH (N-Acylaminoacyl-Peptide Hydrolase (APEH))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser APEH Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- APEH antibody was raised against the N terminal of APEH
- Aufreinigung
- Affinity purified
- Immunogen
- APEH antibody was raised using the N terminal of APEH corresponding to a region with amino acids VYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIAR
- Top Product
- Discover our top product APEH Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
APEH Blocking Peptide, catalog no. 33R-9916, is also available for use as a blocking control in assays to test for specificity of this APEH antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APEH antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APEH (N-Acylaminoacyl-Peptide Hydrolase (APEH))
- Andere Bezeichnung
- APEH (APEH Produkte)
- Synonyme
- AARE antikoerper, ACPH antikoerper, APH antikoerper, D3F15S2 antikoerper, D3S48E antikoerper, DNF15S2 antikoerper, OPH antikoerper, AAP antikoerper, cb5 antikoerper, sb:cb5 antikoerper, wu:fi37d02 antikoerper, acylaminoacyl-peptide hydrolase antikoerper, acylpeptide hydrolase antikoerper, APEH antikoerper, Apeh antikoerper, apeh antikoerper
- Hintergrund
- APEH is the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. This gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma.
- Molekulargewicht
- 81 kDa (MW of target protein)
-