APEH Antikörper (N-Term)

Produktnummer ABIN631156

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch APEH in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für APEH Antikörper (N-Term) (ABIN631156)

Target: APEH (N-Acylaminoacyl-Peptide Hydrolase (APEH))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APEH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-APEH Antikörper

Bindungsspezifität: N-Term

Spezifität: APEH antibody was raised against the N terminal of APEH

Aufreinigung: Affinity purified

Immunogen: APEH antibody was raised using the N terminal of APEH corresponding to a region with amino acids VYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIAR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

APEH Blocking Peptide, (ABIN5612106), is also available for use as a blocking control in assays to test for specificity of this APEH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APEH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APEH

Target: APEH (N-Acylaminoacyl-Peptide Hydrolase (APEH))

Andere Bezeichnung: APEH

Hintergrund: APEH is the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. This gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma.

Molekulargewicht: 81 kDa (MW of target protein)