PNPO Antikörper (N-Term)

Produktnummer ABIN631149

Produktdetails anti-PNPO Antikörper

Target: PNPO (Pyridoxamine 5'-Phosphate Oxidase (PNPO))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PNPO Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PNPO antibody was raised against the N terminal of PNPO

Aufreinigung: Affinity purified

Immunogen: PNPO antibody was raised using the N terminal of PNPO corresponding to a region with amino acids PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLAT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PNPO Blocking Peptide, catalog no. 33R-7225, is also available for use as a blocking control in assays to test for specificity of this PNPO antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPO antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PNPO

Target: PNPO (Pyridoxamine 5'-Phosphate Oxidase (PNPO))

Andere Bezeichnung: PNPO (PNPO Produkte)

Synonyme: im:7138360 antikoerper, ECK1634 antikoerper, JW1630 antikoerper, PDXPO antikoerper, AI415282 antikoerper, pyridoxamine 5'-phosphate oxidase antikoerper, pyridoxine 5'-phosphate oxidase antikoerper, Pyridoxamine 5'-phosphate oxidase antikoerper, pnpo antikoerper, pdxH antikoerper, Mrub_2888 antikoerper, Arnit_1624 antikoerper, Ndas_4168 antikoerper, Mesil_2817 antikoerper, Isop_0296 antikoerper, Despr_1960 antikoerper, Pedsa_1348 antikoerper, Mesop_5639 antikoerper, PNPO antikoerper, Pnpo antikoerper

Hintergrund: PNPO catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5'-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine.

Molekulargewicht: 29 kDa (MW of target protein)