UBE3B Antikörper (Middle Region)

Produktnummer ABIN631147

Produktdetails anti-UBE3B Antikörper

Target: UBE3B (Ubiquitin Protein Ligase E3B (UBE3B))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE3B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UBE3 B antibody was raised against the middle region of UBE3

Aufreinigung: Affinity purified

Immunogen: UBE3 B antibody was raised using the middle region of UBE3 corresponding to a region with amino acids VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE3B Blocking Peptide, catalog no. 33R-9458, is also available for use as a blocking control in assays to test for specificity of this UBE3B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE3B

Target: UBE3B (Ubiquitin Protein Ligase E3B (UBE3B))

Andere Bezeichnung: UBE3B (UBE3B Produkte)

Synonyme: si:dkey-189p24.3 antikoerper, BPIDS antikoerper, AI449831 antikoerper, AU020130 antikoerper, ubiquitin protein ligase E3B antikoerper, ubiquitin-protein ligase E3B antikoerper, ubiquitin protein ligase E3B L homeolog antikoerper, UBE3B antikoerper, ube3b antikoerper, LOC581811 antikoerper, ube3b.L antikoerper, Ube3b antikoerper

Hintergrund: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE3B is a member of the E3 ubiquitin-conjugating enzyme family. UBE3B may interact with other proteins and play a role in stress response.

Molekulargewicht: 123 kDa (MW of target protein)