UBE3B Antikörper (Middle Region)

Produktnummer ABIN631147

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch UBE3B in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für UBE3B Antikörper (Middle Region) (ABIN631147)

Target: UBE3B (Ubiquitin Protein Ligase E3B (UBE3B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE3B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UBE3B Antikörper

Bindungsspezifität: Middle Region

Spezifität: UBE3 B antibody was raised against the middle region of UBE3

Aufreinigung: Affinity purified

Immunogen: UBE3 B antibody was raised using the middle region of UBE3 corresponding to a region with amino acids VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE3B Blocking Peptide, (ABIN5616879), is also available for use as a blocking control in assays to test for specificity of this UBE3B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE3B

Target: UBE3B (Ubiquitin Protein Ligase E3B (UBE3B))

Andere Bezeichnung: UBE3B

Hintergrund: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE3B is a member of the E3 ubiquitin-conjugating enzyme family. UBE3B may interact with other proteins and play a role in stress response.

Molekulargewicht: 123 kDa (MW of target protein)