OGFOD1 Antikörper (Middle Region)

Produktnummer ABIN631145

Der Kaninchen Polyklonal anti-OGFOD1 Antikörper wird verwendet zum Nachweis von OGFOD1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für OGFOD1 Antikörper (Middle Region) (ABIN631145)

Target: OGFOD1 (2-Oxoglutarate and Iron-Dependent Oxygenase Domain Containing 1 (OGFOD1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OGFOD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-OGFOD1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: OGFOD1 antibody was raised against the middle region of OGFOD1

Aufreinigung: Affinity purified

Immunogen: OGFOD1 antibody was raised using the middle region of OGFOD1 corresponding to a region with amino acids GCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OGFOD1 Blocking Peptide, (ABIN938570), is also available for use as a blocking control in assays to test for specificity of this OGFOD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OGFOD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OGFOD1

Target: OGFOD1 (2-Oxoglutarate and Iron-Dependent Oxygenase Domain Containing 1 (OGFOD1))

Andere Bezeichnung: OGFOD1

Hintergrund: The function of OGFOD1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 63 kDa (MW of target protein)